- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H4-K12 Rabbit mAb Catalog No. A22754 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC56881 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.Immunogen information
Immunogen A synthetic acetylated peptide around K12 of human Histone H4(P62805). Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IP ChIP ChIP-seq DB Recommended dilution - DB 1:500 - 1:1000
- WB 1:500 - 1:1000
- IHC-P 1:100 - 1:500
- ChIP 1:50 - 1:200
- ChIP-seq 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa TSA, NIH/3T3 TSA, C6 TSA Cellular location Chromosome, Nucleus 
Chromatin immunoprecipitations were performed with cross-linked chromatin from Hela cells and Acetyl-Histone H4-K12 Rabbit mAb (A22754). The ChIP sequencing results indicate the enrichment pattern of Acetyl-Histone H4-K5/K8/K12/K16 in selected genomic region and representative gene loci (GAPDH), as shown in figure.

Western blot analysis of various lysates, using Acetyl-Histone H4-K12 antibody (A22754) at 1:1000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates, using Acetyl-Histone H4-K12 antibody (A22754) at 1:1000 dilution.NIH/3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of C6, using Acetyl-Histone H4-K12 antibody (A22754) at 1:1000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K12 antibody (A22754) at 1:1000 dilution.

Immunohistochemistry analysis of paraffin-embedded human colon using Acetyl-Histone H4-K12 Rabbit mAb (A22754) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat lung using Acetyl-Histone H4-K12 Rabbit mAb (A22754) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K12 antibody (A22754) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K12 of human Histone H4(P62805). Isotype IgG







