быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Acetyl-Histone H4-K16 Rabbit mAb (A23091)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H4-K16 Rabbit mAb Catalog No. A23091 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55790 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.Immunogen information
Immunogen A synthetic acetylated peptide around K16 of human Histone H4 (NP_003529.1). Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP ChIP DB Recommended dilution - DB 1:100 - 1:500
- WB 1:2000-1:6000
- IHC-P 1:500 - 1:1000
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa TSA, C2C12 TSA, C6 TSA Cellular location Chromosome, Nucleus Customer validation WB(Homo sapiens)
IP(Homo sapiens)
Western blot analysis of HeLa, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:5000 dilution.HeLa cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of C2C12, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:5000 dilution.C2C12 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of C6, using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at 1:5000 dilution.C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K16 antibody (A23091) at 1:500 dilution.
Immunohistochemistry analysis of paraffin-embedded human cervix cancer using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using Acetyl-Histone H4-K16 Rabbit mAb (A23091) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H4-K16 antibody (A23091) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic acetylated peptide around K16 of human Histone H4 (NP_003529.1). Isotype IgG