быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Acetyl-Histone H4-K12 Rabbit mAb (A23683)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H4-K12 Rabbit mAb Catalog No. A23683 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57733 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.Immunogen information
Immunogen A synthetic acetylated peptide around K12 of human Histone H4 (NP_003486.1). Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4/I; H4C1; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FI; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4B Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications IHC-P IP ChIP Recommended dilution - CHIP 1:50 - 1:100
- IHC-P 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunoprecipitation Positive samples HeLa Cellular location Chromosome, Nucleus 
Immunohistochemistry analysis of paraffin-embedded human colon using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 600 μg extracts of HeLa cells using 5 μg Acetyl-Histone H4-K12 Rabbit mAb (A23683). Western blot was performed from the immunoprecipitate using Acetyl-Histone H4-K12 Rabbit mAb (A23683) at a dilition of 1:1000.
Chromatin immunoprecipitation analysis of extracts of Hela cells, using Acetyl-Histone H4-K12 antibody (A23683) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K12 of human Histone H4 (NP_003486.1). Isotype IgG