быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Acetyl-Histone H3-K27 Rabbit mAb (A2771)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H3-K27 Rabbit mAb Catalog No. A2771 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53670 Background
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.Immunogen information
Immunogen A synthetic acetylated peptide around K27 of human Histone H3 (P68431). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC IP ChIP DB CUT&Tag Recommended dilution - DB 1:500 - 1:2000
- WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
- CUT&Tag 10⁵ cells /2 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Immunofluorescence Positive samples HeLa TSA, NIH/3T3 TSA , C6 TSA Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using Acetyl-Histone H3-K27 antibody (A2771) at 1:1000 dilution.HeLa NIH/3T3 and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K27 antibody (A2771) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded human colon using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa treated with TSA and HeLa cells using Acetyl-Histone H3-K27 Rabbit mAb (A2771) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Hela TSA cells using 5 μg Acetyl-Histone H3-K27 antibody (A2771). Western blot was performed from the immunoprecipitate using Acetyl-Histone H3-K27 antibody (A2771) at a dilution of 1:50000.
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K562 cells with 2 ug Acetyl-Histone H3-K27 Rabbit mAb，along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of Acetyl-Histone H3-K27 in representative gene loci (RPL30), as shown in figure.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K27 antibody (A2771) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Acetyl-Histone H3-K27 antibody (A2771) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K27 of human Histone H3 (P68431). Isotype IgG