быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
Acetyl-Histone H4-K5 Rabbit mAb (A19525)
- Описание
- Характеристики
-
Overview
Product name Acetyl-Histone H4-K5 Rabbit mAb Catalog No. A19525 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0002 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.Immunogen information
Immunogen A synthetic acetylated peptide around K5 of human Histone H4 (P62805). Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4 Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC DB Recommended dilution - DB 1:500 - 1:1000
- WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa TSA, NIH/3T3 TSA, C6 TSA Cellular location Chromosome, nucleus Customer validation WB(Mus musculus)
IF(Mus musculus)
Western blot analysis of extracts of various cell lines, using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Dot-blot analysis of all sorts of peptides using Acetyl-Histone H4-K5 antibody (A19525) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded rat brain using Acetyl-Histone H4-K5 antibody (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using Acetyl-Histone H4-K5 antibody (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Acetyl-Histone H4-K5 antibody (A19525) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using Acetyl-Histone H4-K5 antibody (A19525).C6 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using Acetyl-Histone H4-K5 antibody (A19525).NIH-3T3 cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Acetyl-Histone H4-K5 antibody (A19525).U-2 OS cells were treated by TSA (1 uM) at 37℃ for 18 hours(left). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic acetylated peptide around K5 of human Histone H4 (P62805). Isotype IgG