быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Bax Rabbit pAb (A15633)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Bax Rabbit pAb Catalog No. A15633 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-50 of human Bax (NP_620116.1). Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV Gene ID Swiss Prot Synonyms BCL2L4 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HT-1080, Raji Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein Customer validation WB(Capra hircus, Rattus norvegicus)

Western blot analysis of extracts of various cell lines, using [KO Validated] Bax antibody (A15633) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from normal (control) and [KO Validated] Bax knockout (KO) 293T cells, using [KO Validated] Bax antibody (A15633) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-50 of human Bax (NP_620116.1). KO Validated Validated Isotype IgG







