![[KO Validated] CHCHD2 Rabbit pAb (A16645)](/upload/resize_cache/iblock/1bd/340_340_140cd750bba9870f18aada2478b24840a/1tb1v28hvjch0kk1ard2w1pmv2bsl1o0.jpg "[KO Validated] CHCHD2 Rabbit pAb (A16645)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CHCHD2 Rabbit pAb (A16645)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CHCHD2 Rabbit pAb Catalog No. A16645 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1). Sequence TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR Gene ID Swiss Prot Synonyms MNRR1; NS2TP; MIX17B; PARK22; C7orf17 Calculated MW 16kDa Observed MW 16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HT-29, 293T, HepG2, U-87MG, mouse brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using CHCHD2 antibody (A16645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and CHCHD2 knockout (KO) 293T cells, using CHCHD2 antibody (A16645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using [KO Validated] CHCHD2 Rabbit pAb (A16645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Rat ovary using [KO Validated] CHCHD2 Rabbit pAb (A16645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] CHCHD2 Rabbit pAb (A16645) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using CHCHD2 antibody (A16645) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using CHCHD2 antibody (A16645) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using CHCHD2 antibody (A16645) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1). KO Validated Validated Isotype IgG