[KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] PDK1/PDPK1 Rabbit pAb
Catalog No.	A1665
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables 3-phosphoinositide-dependent protein kinase activity; phospholipase activator activity; and phospholipase binding activity. Involved in several processes, including cell surface receptor signaling pathway; regulation of protein kinase activity; and regulation of signal transduction. Acts upstream of or within intracellular signal transduction. Located in cell projection; cytosol; and plasma membrane. Implicated in prostate cancer. Biomarker of lung non-small cell carcinoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1).
Sequence	GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Gene ID
Swiss Prot
Synonyms	PDK1; PDPK2; PDPK2P; PRO0461
Calculated MW	63kDa
Observed MW	58-68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HCT116, Mouse brain, Rat brain
Cellular location	Cell junction, Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, focal adhesion
Customer validation	WB(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) IHC(Homo sapiens,Mus musculus) RIP，WB(Homo sapiens)

Western blot analysis of extracts of various cell lines, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of extracts from normal (control) and PDK1/PDPK1 knockout (KO) HCT116 cells, using PDK1/PDPK1 antibody (A1665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded rat brain using PDPK1 antibody (A1665) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1).
KO Validated	Validated
Isotype	IgG