![[KO Validated] TFAP4 Rabbit pAb (A16727)](/upload/resize_cache/iblock/499/340_340_140cd750bba9870f18aada2478b24840a/7d3xxe7x7d4w9z36hye7d0z4xbdxafvy.jpg "[KO Validated] TFAP4 Rabbit pAb (A16727)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TFAP4 Rabbit pAb (A16727)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TFAP4 Rabbit pAb Catalog No. A16727 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1). Sequence QQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP Gene ID Swiss Prot Synonyms AP-4; bHLHc41 Calculated MW 39kDa Observed MW 42kDa Applications
Reactivity Human, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:200 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HT-29, SGC-7901, 22Rv1, HeLa Cellular location Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using TFAP4 antibody (A16727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts from normal (control) and TFAP4 knockout (KO) HeLa cells, using TFAP4 antibody (A16727) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60S.
Immunofluorescence analysis of C6 cells using TFAP4 antibody (A16727) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using TFAP4 antibody (A16727) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1). KO Validated Validated Isotype IgG