[KO Validated] Cyclin B1 Rabbit pAb (A16800)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Cyclin B1 Rabbit pAb
Catalog No.	A16800
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-433 of human CCNB1 (NP_114172.1).
Sequence	CLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Gene ID
Swiss Prot
Synonyms	CCNB
Calculated MW	48kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Mouse liver
Cellular location	Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Customer validation	WB(Homo sapiens)

Western blot analysis of extracts from normal (control) and Cyclin B1 knockout (KO) HeLa cells, using Cyclin B1 antibody (A16800) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of extracts of Mouse liver, using Cyclin B1 antibody (A16800) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded rat ovary using Cyclin B1 Rabbit pAb (A16800) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using Cyclin B1 Rabbit pAb (A16800) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-433 of human CCNB1 (NP_114172.1).
KO Validated	Validated
Isotype	IgG