![[KO Validated] VAT1 Rabbit pAb (A17077)](/upload/resize_cache/iblock/dcf/340_340_140cd750bba9870f18aada2478b24840a/r75802wff42b5od86c9oe7oawpium97v.jpg "[KO Validated] VAT1 Rabbit pAb (A17077)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] VAT1 Rabbit pAb (A17077)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] VAT1 Rabbit pAb Catalog No. A17077 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2). Sequence GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA Gene ID Swiss Prot Synonyms VATI Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples K-562, U-87MG, 293T Cellular location extracellular exosome, extracellular region, mitochondrial outer membrane 
Western blot analysis of extracts of various cell lines, using VAT1 antibody (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.
Western blot analysis of extracts from normal (control) and VAT1 knockout (KO) 293T cells, using VAT1 antibody (A17077) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of L929 cells using VAT1 antibody (A17077) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VAT1 (NP_006364.2). KO Validated Validated Isotype IgG