![[KO Validated] SIRT3 Rabbit pAb (A17113)](/upload/resize_cache/iblock/9e9/340_340_140cd750bba9870f18aada2478b24840a/7c6unkzg9ik0agm70bn7zskylvdin0is.jpg "[KO Validated] SIRT3 Rabbit pAb (A17113)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SIRT3 Rabbit pAb (A17113)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SIRT3 Rabbit pAb Catalog No. A17113 Host species Rabbit Purification method Affinity purification Isotype IgG Background
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). Sequence QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Gene ID Swiss Prot Synonyms SIR2L3 Calculated MW 44kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T, HepG2, Mouse liver, Rat liver Cellular location Mitochondrion matrix Customer validation IF(Mus musculus)
WB(Mus musculus)
(Mus musculus)
WB(Nothobranchius)
IHC(Nothobranchius)
Western blot analysis of extracts of HepG2 cells, using SIRT3 antibody (A17113) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from normal (control) and SIRT3 knockout (KO) 293T cells, using SIRT3 antibody (A17113) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] SIRT3 Rabbit pAb (A17113) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). KO Validated Validated Isotype IgG