![[KO Validated] SLC25A22 Rabbit pAb (A17772)](/upload/resize_cache/iblock/233/340_340_140cd750bba9870f18aada2478b24840a/ewkm09mhmp7it427l9ct6lgdx24at93y.jpg "[KO Validated] SLC25A22 Rabbit pAb (A17772)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SLC25A22 Rabbit pAb (A17772)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SLC25A22 Rabbit pAb Catalog No. A17772 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a mitochondrial glutamate carrier. Mutations in this gene are associated with early infantile epileptic encephalopathy. Multiple alternatively spliced variants, encoding the same protein, have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). Sequence KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK Gene ID Swiss Prot Synonyms GC1; DEE3; GC-1; EIEE3; NET44 Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples U-87MG, HepG2, A-549, A-431, Mouse brain, Rat brain, 293T Cellular location mitochondrial inner membrane 
Western blot analysis of extracts of various cell lines, using SLC25A22 antibody (A17772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from normal (control) and SLC25A22 knockout (KO) 293T cells, using SLC25A22 antibody (A17772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of C6 cells using SLC25A22 antibody (A17772) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using SLC25A22 antibody (A17772) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). KO Validated Validated Isotype IgG