быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Sonic Hedgehog (Shh) Rabbit pAb (A18020)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Sonic Hedgehog (Shh) Rabbit pAb Catalog No. A18020 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities. Additionally, mutations in a long range enhancer located approximately 1 megabase upstream of this gene disrupt limb patterning and can result in preaxial polydactyly.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog (Shh) (NP_000184.1). Sequence PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG Gene ID Swiss Prot Synonyms TPT; HHG1; HLP3; HPE3; SMMCI; ShhNC; TPTPS; MCOPCB5 Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cell membrane, Lipid-anchor, Secreted, extracellular space 
Western blot analysis of extracts from normal (control) and Sonic Hedgehog (Sonic Hedgehog (Shh)) knockout (KO) HeLa cells, using Sonic Hedgehog (Sonic Hedgehog (Shh)) antibody (A18020) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog (Shh) (NP_000184.1). KO Validated Validated Isotype IgG







