быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CRY1 Rabbit pAb (A18028)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CRY1 Rabbit pAb Catalog No. A18028 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Loss of the related gene in mouse results in a shortened circadian cycle in complete darkness.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 507-586 of human CRY1 (NP_004066.1). Sequence PNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN Gene ID Swiss Prot Synonyms DSPD; PHLL1 Calculated MW 66kDa Observed MW 65kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts from normal (control) and CRY1 knockout (KO) HeLa cells, using CRY1 antibody (A18028) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 507-586 of human CRY1 (NP_004066.1). KO Validated Validated Isotype IgG







