[KO Validated] CD147/BSG Rabbit pAb (A18032)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] CD147/BSG Rabbit pAb
Catalog No.	A18032
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human CD147/CD147/BSG (NP_940991.1).
Sequence	DSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL
Gene ID
Swiss Prot
Synonyms	OK; 5F7; TCSF; CD147; EMPRIN; HAb18G; EMMPRIN
Calculated MW	42kDa
Observed MW	48-58kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Cell membrane, Melanosome, Single-pass type I membrane protein

Western blot analysis of extracts from normal (control) and CD147/CD147/BSG knockout (KO) 293T cells, using CD147/CD147/BSG antibody (A18032) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 45-200 of human CD147/CD147/BSG (NP_940991.1).
KO Validated	Validated
Isotype	IgG