![[KO Validated] RAB11A Rabbit pAb (A18048)](/upload/resize_cache/iblock/118/340_340_140cd750bba9870f18aada2478b24840a/ioc4qhtu63at11wv5jzq46lp9eo5xqy2.jpg "[KO Validated] RAB11A Rabbit pAb (A18048)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] RAB11A Rabbit pAb (A18048)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] RAB11A Rabbit pAb Catalog No. A18048 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (NP_004654.1). Sequence ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV Gene ID Swiss Prot Synonyms YL8 Calculated MW 24kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cell membrane, Cleavage furrow, Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, Peripheral membrane protein, Recycling endosome membrane, phagosome, phagosome membrane 
Western blot analysis of extracts from normal (control) and RAB11A knockout (KO) HeLa cells, using RAB11A antibody (A18048) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (NP_004654.1). KO Validated Validated Isotype IgG