[KO Validated] CDX2 Rabbit mAb (A19030)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] CDX2 Rabbit mAb
Catalog No.	A19030
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0450

Background

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626).
Sequence	MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
Gene ID
Swiss Prot
Synonyms	CDX3; CDX-3; CDX2/AS
Calculated MW	34kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	SW480 cells, 293T cells
Cellular location	Nucleus

Western blot analysis of extracts of various cell lines, using CDX2 antibody (A19030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of extracts from wild type(WT) and CDX2 knockout (KO) 293T cells, using CDX2 antibody (A19030) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry of paraffin-embedded human appendix using [KO Validated] CDX2 Rabbit mAb (A19030) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] CDX2 Rabbit mAb (A19030) at dilution of 1:800 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Confocal imaging of Human colon using [KO Validated] CDX2 Rabbit mAb (A19030, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunoprecipitation analysis of 600 μg extracts of 293T cells using 3 μg CDX2 antibody (A19030). Western blot was performed from the immunoprecipitate using CDX2 antibody (A19030) at a dilution of 1:500.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDX2 (Q99626).
KO Validated	Validated
Isotype	IgG