![[KO Validated] MyD88 Rabbit mAb (A19082)](/upload/resize_cache/iblock/cb9/340_340_140cd750bba9870f18aada2478b24840a/747ordgr722leodv3eygopf3ver0uhzz.jpg "[KO Validated] MyD88 Rabbit mAb (A19082)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MyD88 Rabbit mAb (A19082)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MyD88 Rabbit mAb Catalog No. A19082 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52507 Background
This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3). Sequence LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL Gene ID Swiss Prot Synonyms WM1; IMD68; MYD88D Calculated MW 15kDa/20kDa/28kDa/31kDa/33kDa/34kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, A549 Cellular location Cytoplasm 
Western blot analysis of extracts from wild type (WT) and MyD88 knockout (KO) HeLa cells, using MyD88 antibody (A19082) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of A549, using Aquaporin-4 (AQP4) Rabbit mAb (A19082) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using [KO Validated] MyD88 Rabbit mAb (A19082) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using [KO Validated] MyD88 Rabbit mAb (A19082) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using [KO Validated] MyD88 Rabbit mAb (A19082) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3). KO Validated Validated Isotype IgG