![[KO Validated] Src Rabbit mAb (A19119)](/upload/resize_cache/iblock/864/340_340_140cd750bba9870f18aada2478b24840a/p6j63ijcualw5o08kgitaomvx58vdq1u.jpg "[KO Validated] Src Rabbit mAb (A19119)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Src Rabbit mAb (A19119)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Src Rabbit mAb Catalog No. A19119 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0378 Background
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931). Sequence MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE Gene ID Swiss Prot Synonyms ASV; SRC1; THC6; c-SRC; p60-Src Calculated MW 60kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, Jurkat, Mouse brain, Mouse lung, Rat brain Cellular location Cell membrane, Cytoplasm, Mitochondrion inner membrane, Nucleus, cytoskeleton Customer validation WB(Homo sapiens, Rattus norvegicus, Mus musculus)
IF(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Src antibody (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type (WT) and Src knockout (KO) HeLa cells, using Src antibody (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Western blot analysis of extracts of Jurkat cells, using Src antibody (A19119) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (A19119, at dilution of 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg Src antibody (A19119). Western blot was performed from the immunoprecipitate using Src antibody (A19119) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931). KO Validated Validated Isotype IgG