![[KO Validated] ERK1 Rabbit mAb (A19561)](/upload/resize_cache/iblock/5ca/340_340_140cd750bba9870f18aada2478b24840a/6qx1bsnb4gb1xj4bery3qzs02so7re2b.jpg "[KO Validated] ERK1 Rabbit mAb (A19561)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ERK1 Rabbit mAb (A19561)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ERK1 Rabbit mAb Catalog No. A19561 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2591 Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERK1 (P27361). Sequence MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV Gene ID Swiss Prot Synonyms ERK1; ERT2; ERK-1; PRKM3; P44ERK1; P44MAPK; HS44KDAP; HUMKER1A; p44-ERK1; p44-MAPK Calculated MW 43kDa Observed MW 44kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples 293T, HeLa, HT-29 Cellular location Cytoplasm, Nucleus Customer validation WB(Rattus norvegicus, Homo sapiens, Mus musculus)
Western blot analysis of various lysates, using ERK1 antibody (A19561) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type(WT) and ERK1 knockout (KO) 293T cells, using ERK1 antibody (A19561) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ERK1 Rabbit mAb (A19561) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using ERK1 Rabbit mAb (A19561) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg ERK1 antibody (A19561). Western blot was performed from the immunoprecipitate using ERK1 antibody (A19561) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ERK1 (P27361). KO Validated Validated Isotype IgG