[KO Validated] STAT3 Rabbit mAb (A19566)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] STAT3 Rabbit mAb
Catalog No.	A19566
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2603

Background

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (P40763).
Sequence	TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
Gene ID
Swiss Prot
Synonyms	APRF; HIES; ADMIO; ADMIO1
Calculated MW	88kDa
Observed MW	86kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, A549, NIH/3T3, C6, Mouse liver
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus, Staphylococcus aureus) IF(Homo sapiens) IP(Homo sapiens) RT-qPCR(Homo sapiens)

Western blot analysis of various lysates, using STAT3 antibody (A19566) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts from normal (control) and STAT3 knockout (KO) HeLa(KO) cells, using STAT3 antibody (A19566) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (P40763).
KO Validated	Validated
Isotype	IgG