[KO Validated] Vimentin Rabbit mAb (A19607)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Vimentin Rabbit mAb
Catalog No.	A19607
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0086

Background

This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670).
Sequence	DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Gene ID
Swiss Prot
Synonyms	CTRCT30; HEL113; Vimentin; VIM; vimentin
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:2000 - 1:20000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T cells, Jurkat cells, HeLa cells, C6 cells, Mouse testis
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus, Chlorocebus aethiops) IF(Mus musculus) IHC(Homo sapiens, Mus musculus) IF(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Mus musculus) WB，IF，IHC(Mus musculus) WB(Homo sapiens,Mus musculus)

Western blot analysis of extracts of various cell lines, using Vimentin antibody (A19607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts from wild type (WT) and Vimentin knockout (KO) 293T cells, using Vimentin antibody (A19607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded human colon using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human lung cancer using [KO Validated] Vimentin Rabbit mAb (A19607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Confocal Immunofluorescence analysis of U2OS cells using KRR1 Rabbit pAb (A4487) at dilution of 1:100 (40x lens)(red). Vimentin (A19607: Vimentin Rabbit mAb) for Cytoskeleton staining(green), DAPI for nuclear staining(blue).

Confocal imaging of HeLa cells using [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). The cells were counterstained with Aurora B Rabbit mAb (A19539, dilution 1:800) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg Vimentin antibody (A19607). Western blot was performed from the immunoprecipitate using Vimentin antibody (A19607) at a dilution of 1:1000.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670).
KO Validated	Validated
Isotype	IgG