![[KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)](/upload/resize_cache/iblock/819/340_340_140cd750bba9870f18aada2478b24840a/31j35gefhhd8vzoys9pf8cya2djz5c2r.jpg "[KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] active + pro Caspase-3 Rabbit mAb Catalog No. A19654 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0133 Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574). Sequence SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD Gene ID Swiss Prot Synonyms CPP32; SCA-1; CPP32B Calculated MW 32kDa Observed MW 17kDa/32kDa/35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, Jurkat, L929, NIH/3T3, Mouse lung, Mouse liver, Rat liver Cellular location Cytoplasm Customer validation WB(Mus musculus, Homo sapiens, Sanghuangporus vaninii, Giardia duodenalis, Rattus norvegicus, Apocynum venetum leaf, Gallus gallus, Bos taurus)
IP(Rattus norvegicus)
IF(Mus musculus,Homo sapiens)
Western blot analysis of various lysates, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of Jurkat, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of L929, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and active + pro Caspase-3 knockout (KO) 293T cells, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574). KO Validated Validated Isotype IgG