![[KO Validated] SIRT1 Rabbit mAb (A19667)](/upload/resize_cache/iblock/4ca/340_340_140cd750bba9870f18aada2478b24840a/thwzp2kld7m3zifidtoxzigkgum8yk3t.jpg "[KO Validated] SIRT1 Rabbit mAb (A19667)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SIRT1 Rabbit mAb (A19667)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SIRT1 Rabbit mAb Catalog No. A19667 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0146 Background
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 648-747 of human SIRT1 (Q96EB6). Sequence NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS Gene ID Swiss Prot Synonyms SIR2; SIR2L1; SIR2alpha Calculated MW 82kDa Observed MW 120kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa Cellular location Cytoplasm, Mitochondrion, Nucleus, Nucleus, PML body Customer validation (PC-3、MOLT-4、MCF-7)
WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts from wild type (WT) and SIRT1 knockout (KO) HeLa cells, using SIRT1 antibody (A19667) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of HeLa cells using SIRT1 antibody (A19667). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 648-747 of human SIRT1 (Q96EB6). KO Validated Validated Isotype IgG
