быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ATG4A Rabbit pAb (A19844)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ATG4A Rabbit pAb Catalog No. A19844 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). Sequence TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV Gene ID Swiss Prot Synonyms APG4A; AUTL2; HsAPG4A Calculated MW 45kDa Observed MW 50kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm 
Western blot analysis of extracts from normal (control) and ATG4A knockout (KO) HeLa cells, using ATG4A antibody (A19844) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). KO Validated Validated Isotype IgG







