![[KO Validated] TXNDC9 Rabbit pAb (A19869)](/upload/resize_cache/iblock/b0a/340_340_140cd750bba9870f18aada2478b24840a/kga2mze7xh00141ar55moe5b0yi7ydmu.jpg "[KO Validated] TXNDC9 Rabbit pAb (A19869)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TXNDC9 Rabbit pAb (A19869)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TXNDC9 Rabbit pAb Catalog No. A19869 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2). Sequence MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRH Gene ID Swiss Prot Synonyms APACD; PHLP3 Calculated MW 27kDa Observed MW 26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm, Midbody, Nucleus, centrosome, cytoskeleton, microtubule organizing center 
Western blot analysis of extracts from normal (control) and TXNDC9 knockout (KO) HeLa cells, using TXNDC9 antibody (A19869) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2). KO Validated Validated Isotype IgG