+7-495-308-45-67 Заказать звонок

[KO Validated] VAV2 Rabbit pAb (A19883)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] VAV2 Rabbit pAb
Catalog No.	A19883
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

VAV2 is the second member of the VAV guanine nucleotide exchange factor family of oncogenes. Unlike VAV1, which is expressed exclusively in hematopoietic cells, VAV2 transcripts were found in most tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 570-700 of human VAV2 (NP_001127870.1).
Sequence	PPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRER
Gene ID
Swiss Prot
Synonyms	VAV-2
Calculated MW	101kDa
Observed MW	95kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	cytoplasm, cytosol, plasma membrane

Western blot analysis of extracts from normal (control) and VAV2 knockout (KO) HeLa cells, using VAV2 antibody (A19883) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 570-700 of human VAV2 (NP_001127870.1).
KO Validated	Validated
Isotype	IgG