![[KO Validated] CCDC6 Rabbit pAb (A19901)](/upload/resize_cache/iblock/78f/340_340_140cd750bba9870f18aada2478b24840a/ge8667h56183pv7o661u0x0vpvi11qzq.jpg "[KO Validated] CCDC6 Rabbit pAb (A19901)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CCDC6 Rabbit pAb (A19901)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CCDC6 Rabbit pAb Catalog No. A19901 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2). Sequence RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD Gene ID Swiss Prot Synonyms H4; PTC; TPC; PTC1; TST1; D10S170 Calculated MW 53kDa Observed MW 68kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts from normal (control) and CCDC6 knockout (KO) HeLa cells, using CCDC6 antibody (A19901) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2). KO Validated Validated Isotype IgG