![[KO Validated] ATOX1 Rabbit pAb (A19925)](/upload/resize_cache/iblock/ae0/340_340_140cd750bba9870f18aada2478b24840a/0fn2b8q6k1flkqc19nwzkpatura02j2d.jpg "[KO Validated] ATOX1 Rabbit pAb (A19925)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ATOX1 Rabbit pAb (A19925)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ATOX1 Rabbit pAb Catalog No. A19925 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). Sequence MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Gene ID Swiss Prot Synonyms ATX1; HAH1 Calculated MW 7kDa Observed MW 7kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location cytosol 
Western blot analysis of extracts from normal (control) and ATOX1 knockout (KO) 293T cells, using ATOX1 antibody (A19925) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human ATOX1 (NP_004036.1). KO Validated Validated Isotype IgG