[KO Validated] PACSIN2 Rabbit pAb (A19941)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] PACSIN2 Rabbit pAb
Catalog No.	A19941
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 240-410 of human PACSIN2 (NP_009160.2).
Sequence	RLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSST
Gene ID
Swiss Prot
Synonyms	SDPII
Calculated MW	56kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle membrane, Early endosome, Membrane, Peripheral membrane protein, Recycling endosome membrane, caveola, cytoskeleton, ruffle membrane

Western blot analysis of extracts from normal (control) and PACSIN2 knockout (KO) HeLa cells, using PACSIN2 antibody (A19941) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 240-410 of human PACSIN2 (NP_009160.2).
KO Validated	Validated
Isotype	IgG