![[KO Validated] ATPIF1 Rabbit pAb (A19946)](/upload/resize_cache/iblock/753/340_340_140cd750bba9870f18aada2478b24840a/8qrcgji3qhx6agbnycw0pifov0l766yz.jpg "[KO Validated] ATPIF1 Rabbit pAb (A19946)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ATPIF1 Rabbit pAb (A19946)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ATPIF1 Rabbit pAb Catalog No. A19946 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). Sequence GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD Gene ID Swiss Prot Synonyms IP; ATPI; ATPIP; ATPIF1 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Mitochondrion 
Western blot analysis of extracts from normal (control) and ATPIF1 knockout (KO) 293T cells, using ATPIF1 antibody (A19946) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). KO Validated Validated Isotype IgG