![[KO Validated] UQCC2 Rabbit pAb (A19955)](/upload/resize_cache/iblock/5fc/340_340_140cd750bba9870f18aada2478b24840a/1md8kuvnl4pwdj60ofra0yu0zyidsibl.jpg "[KO Validated] UQCC2 Rabbit pAb (A19955)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] UQCC2 Rabbit pAb (A19955)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] UQCC2 Rabbit pAb Catalog No. A19955 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1). Sequence EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA Gene ID Swiss Prot Synonyms M19; Cbp6; MNF1; MC3DN7; C6orf125; C6orf126; bA6B20.2 Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Mitochondrion matrix, mitochondrion nucleoid 
Western blot analysis of extracts from normal (control) and UQCC2 knockout (KO) 293T cells, using UQCC2 antibody (A19955) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1). KO Validated Validated Isotype IgG