![[KO Validated] ACADVL Rabbit pAb (A19973)](/upload/resize_cache/iblock/489/340_340_140cd750bba9870f18aada2478b24840a/x7az0ssri98il3ysw5sc1akaetgt425s.jpg "[KO Validated] ACADVL Rabbit pAb (A19973)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ACADVL Rabbit pAb (A19973)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ACADVL Rabbit pAb Catalog No. A19973 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ACADVL (NP_000009.1). Sequence MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPAKNDALEMVEETTWQGLKELG Gene ID Swiss Prot Synonyms ACAD6; LCACD; VLCAD Calculated MW 70kDa Observed MW 68kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T Cellular location Mitochondrion inner membrane 
Western blot analysis of extracts from normal (control) and ACADVL knockout (KO) 293T cells, using ACADVL antibody (A19973) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human ACADVL (NP_000009.1). KO Validated Validated Isotype IgG