![[KO Validated] USP14 Rabbit pAb (A19998)](/upload/resize_cache/iblock/97f/340_340_140cd750bba9870f18aada2478b24840a/4ejteftoohgl1elgw323g82bj789u0lr.jpg "[KO Validated] USP14 Rabbit pAb (A19998)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] USP14 Rabbit pAb (A19998)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] USP14 Rabbit pAb Catalog No. A19998 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1). Sequence KYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ Gene ID Swiss Prot Synonyms TGT; Ubp6 Calculated MW 56kDa Observed MW 62kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location cell surface, cytoplasmic vesicle, cytosol, extracellular exosome, plasma membrane 
Western blot analysis of extracts from normal (control) and USP14 knockout (KO) HeLa cells, using USP14 antibody (A19998) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human USP14 (NP_005142.1). KO Validated Validated Isotype IgG