![[KO Validated] HNRNPR Rabbit pAb (A19999)](/upload/resize_cache/iblock/182/340_340_140cd750bba9870f18aada2478b24840a/ke1sr5hm6uyupcs9w854s1ehufmpcghy.jpg "[KO Validated] HNRNPR Rabbit pAb (A19999)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HNRNPR Rabbit pAb (A19999)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HNRNPR Rabbit pAb Catalog No. A19999 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1). Sequence RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK Gene ID Swiss Prot Synonyms HNRPR; NEDDFSB; hnRNP-R Calculated MW 71kDa Observed MW 69kDa/82kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Cytoplasm, Nucleus, nucleoplasm 
Western blot analysis of extracts from normal (control) and HNRNPR knockout (KO) 293T cells, using HNRNPR antibody (A19999) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1). KO Validated Validated Isotype IgG