![[KO Validated] BRD4 Rabbit pAb (A20019)](/upload/resize_cache/iblock/430/340_340_140cd750bba9870f18aada2478b24840a/b259kwdlu1qm2id5pve3ndvnzemcookv.jpg "[KO Validated] BRD4 Rabbit pAb (A20019)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] BRD4 Rabbit pAb (A20019)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] BRD4 Rabbit pAb Catalog No. A20019 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 623-722 of human BRD4 (NP_055114.1). Sequence NKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETGPA Gene ID Swiss Prot Synonyms CAP; MCAP; HUNK1; HUNKI; FSHRG4 Calculated MW 80kDa/88kDa/152kDa Observed MW 200kDa/140kDa/120kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, HeLa-BRD4-FL, HeLa-BRD4-S(a), HeLa-BRD4-S(b) Cellular location Chromosome, Nucleus 
Western blot analysis of extracts from normal (control) and BRD4 Rabbit pAb knockout (KO) HeLa cells, using BRD4 Rabbit pAb antibody (A20019) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 623-722 of human BRD4 (NP_055114.1). KO Validated Validated Isotype IgG