- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Bax Rabbit mAb Catalog No. A20227 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC5006-10 Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1). Sequence GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL Gene ID Swiss Prot Synonyms BCL2L4 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:2000 - 1:10000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples 293T, HT-1080, RAW264.7 Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein Customer validation WB(Rattus norvegicus, Mus musculus)
IF(Rattus norvegicus)

Western blot analysis of various lysates, using Bax antibody (A20227) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from wild type(WT) and Bax knockout (KO) 293T cells, using Bax antibody (A20227) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat lymph node using Bax Rabbit mAb (A20227) at dilution of 1:50,1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Bax Rabbit mAb (A20227) at dilution of 1:50,1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse spleen using Bax Rabbit mAb (A20227) at dilution of 1:50,1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of C6 cells using Bax Rabbit mAb (A20227) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using Bax Rabbit mAb (A20227) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Bax Rabbit mAb (A20227) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg Bax antibody (A20227). Western blot was performed from the immunoprecipitate using Bax antibody (A20227) at a dilution of 1:500.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 10-70 of human Bax (NP_620116.1). KO Validated Validated Isotype IgG







