![[KO Validated] SIRT3 Rabbit mAb (A20805)](/upload/resize_cache/iblock/b4b/340_340_140cd750bba9870f18aada2478b24840a/g55r46vaz26ycn9g0y3v77p48zgjbh9y.jpg "[KO Validated] SIRT3 Rabbit mAb (A20805)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SIRT3 Rabbit mAb (A20805)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SIRT3 Rabbit mAb Catalog No. A20805 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51526 Background
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). Sequence QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Gene ID Swiss Prot Synonyms SIR2L3 Calculated MW 44kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, HepG2, Rat liver Cellular location Mitochondrion matrix Customer validation WB(Rattus norvegicus)
Western blot analysis of various lysates, using SIRT3 antibody (A20805) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] SIRT3 Rabbit mAb (A20805) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug SIRT3 Rabbit mAb (A20805). Western blot was performed from the immunoprecipitate using SIRT3 Rabbit mAb (A20805) at a dilition of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). KO Validated Validated Isotype IgG