![[KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)](/upload/resize_cache/iblock/210/340_340_140cd750bba9870f18aada2478b24840a/272n4zw4bd5b1i9n5zw0svv7e966h6go.jpg "[KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SLC25A4/ANT1 Rabbit mAb Catalog No. A20842 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51442 Background
This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2). Sequence LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG Gene ID Swiss Prot Synonyms T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; PEOA2; MTDPS12; MTDPS12A Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T, MCF7, Mouse heart, Rat heart Cellular location Mitochondrion inner membrane, Multi-pass membrane protein 
Western blot analysis of extracts of MCF7 cells, using SLC25A4/ANT1 antibody (A20842) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using SLC25A4/ANT1 antibody (A20842) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type (WT) and SLC25A4/ANT1 knockout (KO) 293T cells, using SLC25A4/ANT1 antibody (A20842) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Confocal imaging of HeLa cells using [KO Validated] SLC25A4/ANT1 Rabbit mAb (A20842, dilution 1:100) (Red). The cells were counterstained with [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg SLC25A4/ANT1 antibody (A20842). Western blot was performed from the immunoprecipitate using SLC25A4/ANT1 antibody (A20842) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A4/ANT1 (NP_001142.2). KO Validated Validated Isotype IgG