[KO Validated] AK2 Rabbit mAb (A20934)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] AK2 Rabbit mAb
Catalog No.	A20934
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2916

Background

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AK2 (P54819).
Sequence	GFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEY
Gene ID
Swiss Prot
Synonyms	ADK2
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IF/ICC
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Hep G2, Mouse liver, Mouse kidney, Mouse heart, Rat liver, Rat kidney
Cellular location	Mitochondrion intermembrane space

Western blot analysis of extracts of various cell lines, using AK2 antibody (A20934) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts from wild type (WT) and AK2 knockout (KO) HeLa cells, using AK2 antibody (A20934) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunofluorescence analysis of HeLa cells using [KO Validated] AK2 Rabbit mAb (A20934) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using [KO Validated] AK2 Rabbit mAb (A20934) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF7 cells using [KO Validated] AK2 Rabbit mAb (A20934) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] AK2 Rabbit mAb (A20934) at dilution of 1:20 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AK2 (P54819).
KO Validated	Validated
Isotype	IgG