![[KO Validated] PRMT4/CARM1 Rabbit mAb (A21106)](/upload/resize_cache/iblock/6b7/340_340_140cd750bba9870f18aada2478b24840a/fyv967dcn98j2cklrz3hq0f6hila7idm.jpg "[KO Validated] PRMT4/CARM1 Rabbit mAb (A21106)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] PRMT4/CARM1 Rabbit mAb (A21106)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] PRMT4/CARM1 Rabbit mAb Catalog No. A21106 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC52397 Background
This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1). Sequence GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT Gene ID Swiss Prot Synonyms PRMT4 Calculated MW 66kDa Observed MW 60kDa/63kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples MCF7, 293T, Mouse testis, Rat testis Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of MCF7 cells, using PRMT4/CARM1 antibody (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using PRMT4/CARM1 antibody (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type (WT) and PRMT4/CARM1 knockout (KO) 293T cells, using PRMT4/CARM1 antibody (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg PRMT4/CARM1 antibody (A21106). Western blot was performed from the immunoprecipitate using PRMT4/CARM1 antibody (A21106) at a dilution of1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1). KO Validated Validated Isotype IgG