![[KO Validated] CDK4 Rabbit pAb (A21317)](/upload/resize_cache/iblock/007/340_340_140cd750bba9870f18aada2478b24840a/5nh2m4ah1h4ra6mfwzz9tg9dajtofr4c.jpg "[KO Validated] CDK4 Rabbit pAb (A21317)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDK4 Rabbit pAb (A21317)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDK4 Rabbit pAb Catalog No. A21317 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-303 of human CDK4 (NP_000066.1). Sequence VGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Gene ID Swiss Prot Synonyms CMM3; PSK-J3 Calculated MW 34kDa Observed MW 35kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:100
- IP 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Immunofluorescence Positive samples HeLa, 293T Cellular location Cytoplasm, Membrane, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CDK4 antibody (A21317) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of 293T cells, using CDK4 antibody (A21317) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type (WT) and CDK4 knockout (KO) HeLa cells, using CDK4 antibody (A21317) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human colon using CDK4 antibody (A21317) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 using CDK4 antibody (A21317) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg CDK4 antibody (A21317). Western blot was performed from the immunoprecipitate using CDK4 antibody (A21317) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-303 of human CDK4 (NP_000066.1). KO Validated Validated Isotype IgG