![[KO Validated] PARP1 Rabbit pAb (A21365)](/upload/resize_cache/iblock/e0a/340_340_140cd750bba9870f18aada2478b24840a/82en8o2lpbfzxrnpw07vc3x8vsugai3t.jpg "[KO Validated] PARP1 Rabbit pAb (A21365)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] PARP1 Rabbit pAb (A21365)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] PARP1 Rabbit pAb Catalog No. A21365 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2). Sequence PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG Gene ID Swiss Prot Synonyms PARP; PARS; PPOL; ADPRT; ARTD1; ADPRT1; PARP-1; ADPRT 1; pADPRT-1; Poly-PARP Calculated MW 113kDa Observed MW 114kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:6000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa Cellular location Nucleus, nucleolus Customer validation WB(Homo sapiens)
Western blot analysis of extracts from wild type(WT) and PARP1 knockout (KO) HeLa cells, using PARP1 antibody (A21365) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using [KO Validated] PARP1 Rabbit pAb (A21365) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using [KO Validated] PARP1 Rabbit pAb (A21365) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using [KO Validated] PARP1 Rabbit pAb (A21365) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using [KO Validated] PARP1 Rabbit pAb (A21365) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2). KO Validated Validated Isotype IgG