[KO Validated] eIF4E Rabbit pAb (A2162)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] eIF4E Rabbit pAb
Catalog No.	A2162
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Sequence	MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Gene ID
Swiss Prot
Synonyms	CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:200 IP 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HeLa, K-562
Cellular location	Cytoplasm, P-body
Customer validation	IF(RD cell, Homo sapiens) WB(Human cells, HEK293T, A172, Homo sapiens, Microplitis bicoloratus bracovirus, Mus musculus) IF(Homo sapiens)

Western blot analysis of various lysates, using eIF4E antibody (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Western blot analysis of extracts from wild type(WT) and eIF4E knockout (KO) 293T(KO) cells, using eIF4E antibody (A2162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Immunohistochemistry analysis of paraffin-embedded human lung cancer using eIF4E antibody (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human stomach using eIF4E antibody (A2162) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunofluorescence analysis of U2OS cells using eIF4E antibody (A2162) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg eIF4E antibody (A2162). Western blot was performed from the immunoprecipitate using eIF4E antibody (A2162) at a dilution of 1:1000.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
KO Validated	Validated
Isotype	IgG