![[KO Validated] SUMO1 Rabbit pAb (A21643)](/upload/resize_cache/iblock/0c6/340_340_140cd750bba9870f18aada2478b24840a/xn71fkbkszgu70iqclfiaqsyzfux0ev0.jpg "[KO Validated] SUMO1 Rabbit pAb (A21643)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SUMO1 Rabbit pAb (A21643)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SUMO1 Rabbit pAb Catalog No. A21643 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of human SUMO1 (NP_003343.1). Sequence MTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST Gene ID Swiss Prot Synonyms DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3 Calculated MW 12kDa Observed MW 16kDa/80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:100
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T Cellular location Cell membrane, Cytoplasm, Nucleus, Nucleus membrane, Nucleus speckle, PML body 
Western blot analysis of extracts from wild type(WT) and SUMO1 Rabbit pAb knockout (KO) 293T cells, using SUMO1 Rabbit pAb antibody (A21643) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using SUMO1 antibody (A21643) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using SUMO1 antibody (A21643) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using SUMO1 antibody (A21643) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using SUMO1 antibody (A21643) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using SUMO1 antibody (A21643) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using SUMO1 antibody (A21643) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of human SUMO1 (NP_003343.1). KO Validated Validated Isotype IgG