быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Claudin 1 Rabbit pAb (A21770)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Claudin 1 Rabbit pAb Catalog No. A21770 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 137-211 of human Claudin 1 (NP_066924.1). Sequence TAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Gene ID Swiss Prot Synonyms CLD1; SEMP1; ILVASC Calculated MW 23kDa Observed MW 22kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-431 Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, tight junction 
Western blot analysis of A-431, using Claudin 1 Rabbit pAb (A21770) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts from wild type(WT) and Claudin 1 Rabbit pAb knockout (KO) HepG2(KD) cells, using Claudin 1 Rabbit pAb (A21770) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 137-211 of human Claudin 1 (NP_066924.1). KO Validated Validated Isotype IgG







