![[KO Validated] MIF Rabbit pAb (A22014)](/upload/resize_cache/iblock/e42/340_340_140cd750bba9870f18aada2478b24840a/79cr29r4203hbr5urvy5d6rvpxl2a9dl.jpg "[KO Validated] MIF Rabbit pAb (A22014)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MIF Rabbit pAb (A22014)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MIF Rabbit pAb Catalog No. A22014 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-115 of human MIF (NP_002406.1). Sequence PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Gene ID Swiss Prot Synonyms GIF; GLIF; MMIF Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, HL-60, Mouse brain, Mouse thymus, Rat brain, Rat testis Cellular location cell surface, cytoplasm, cytosol, extracellular exosome, extracellular region, extracellular space, nucleoplasm, plasma membrane 
Western blot analysis of various lysates, using MIF Rabbit pAb antibody (A22014) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of various lysates, using MIF Rabbit pAb antibody (A22014) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and MIF Rabbit pAb knockout (KO) 293T cells, using MIF Rabbit pAb antibody (A22014) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-115 of human MIF (NP_002406.1). KO Validated Validated Isotype IgG