+7-495-308-45-67 Заказать звонок

[KO Validated] Beclin 1 Rabbit mAb (A22361)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Beclin 1 Rabbit mAb
Catalog No.	A22361
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52858

Background

This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
Sequence	MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
Gene ID
Swiss Prot
Synonyms	ATG6; VPS30; beclin1
Calculated MW	52kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IF/ICC
Recommended dilution	WB 1:2000 - 1:10000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HeLa, Jurkat, Mouse spleen, Mouse testis, Rat lung
Cellular location	Endoplasmic reticulum, Mitochondria, Nucleus

Western blot analysis of various lysates, using Beclin1 antibody (A22361) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of Rat lung, using Beclin1 antibody (A22361) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates, using [KO Validated] Beclin 1 Rabbit mAb (A22361) at 1:8000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of extracts from wild type(WT) and [KO Validated] Beclin 1 knockout (KO) 293T(KO) cells, using [KO Validated] Beclin 1 Rabbit mAb (A22361) at 1:8000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Immunofluorescence analysis of C6 using [KO Validated] Beclin 1 Rabbit mAb (A22361) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa using [KO Validated] Beclin 1 Rabbit mAb (A22361) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 using [KO Validated] Beclin 1 Rabbit mAb (A22361) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 using [KO Validated] Beclin 1 Rabbit mAb (A22361) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunofluorescence
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1).
KO Validated	Validated
Isotype	IgG