![[KO Validated] SIRT3 Rabbit mAb (A22409)](/upload/resize_cache/iblock/016/340_340_140cd750bba9870f18aada2478b24840a/lighigdcmn7k0gpyx5g7r8sd50ptvizw.jpg "[KO Validated] SIRT3 Rabbit mAb (A22409)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] SIRT3 Rabbit mAb (A22409)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] SIRT3 Rabbit mAb Catalog No. A22409 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51535 Background
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). Sequence QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK Gene ID Swiss Prot Synonyms SIR2L3 Calculated MW 44kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using SIRT3 antibody (A22409) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
Western blot analysis of extracts of Mouse kidney, using SIRT3 antibody (A22409) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from wild type (WT) and SIRT3 knockout (KO) 293T cells, using SIRT3 antibody (A22409) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1). KO Validated Validated Isotype IgG